PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aqcoe1G115900.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Ranunculales; Ranunculaceae; Thalictroideae; Aquilegia
Family HD-ZIP
Protein Properties Length: 236aa    MW: 27014.7 Da    PI: 9.742
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aqcoe1G115900.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.91.7e-1870123356
                        --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
           Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        ++ ++t+eq++ Le+ F+++ ++  e++ +LA++l+L+ rq+ vWFqNrRa++k
  Aqcoe1G115900.2.p  70 RKKRLTNEQIDSLEKSFQEEIKLEPERKMKLAQELELQPRQIAVWFQNRRARWK 123
                        56679************************************************9 PP

2HD-ZIP_I/II118.34.2e-3869160192
        HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                        e+k+rl++eq+ +LE+sF+ee kLeperK++la+eL+lqprq+avWFqnrRAR+k kq+E+ y++Lk+++d + +en++L++ev +L+++l+
  Aqcoe1G115900.2.p  69 ERKKRLTNEQIDSLEKSFQEEIKLEPERKMKLAQELELQPRQIAVWFQNRRARWKVKQMERLYDTLKKEFDVIIRENQKLQAEVINLKAKLE 160
                        69**************************************************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.56E-1859126IPR009057Homeodomain-like
PROSITE profilePS5007117.45965125IPR001356Homeobox domain
CDDcd000861.91E-1468126No hitNo description
SMARTSM003891.3E-1568129IPR001356Homeobox domain
PfamPF000467.7E-1670123IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.0E-1972132IPR009057Homeodomain-like
PROSITE patternPS000270100123IPR017970Homeobox, conserved site
PfamPF021831.4E-8125159IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MVKNTALHVC TTLQTSWPKT LVMGSIKMEV NSTRYGMQVS IDQTPRSIAS SSNNNITKNK  60
KDFHCNYKER KKRLTNEQID SLEKSFQEEI KLEPERKMKL AQELELQPRQ IAVWFQNRRA  120
RWKVKQMERL YDTLKKEFDV IIRENQKLQA EVINLKAKLE DRASAKQGST GYTEASTAEE  180
SVESKSVVVF HSSNNRQATN YQHINVAASA AECNYLFNMD AYNPTSSPYL GALPI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1117125RRARWKVKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007202889.13e-69hypothetical protein PRUPE_ppa015952mg
SwissprotQ9LZR05e-43ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLM5W4894e-69M5W489_PRUPE; Uncharacterized protein
STRINGVIT_08s0007g04200.t016e-62(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.13e-38homeobox 51